PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010554741.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family bZIP
Protein Properties Length: 750aa    MW: 81055.7 Da    PI: 5.4814
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010554741.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.82.7e-14230290161
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                     e++ kr  r+++NRe+A+ sRqRKk ++eeLeekv ++ +   +L ++++    e a+l++
  XP_010554741.1 230 EEDEKRNVRLMRNRESAQLSRQRKKHYVEELEEKVRTMHSTIADLNSKISYFMAENATLRQ 290
                     6788*********************************************999999988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-15230294IPR004827Basic-leucine zipper domain
PfamPF001705.5E-12231290IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.231232291IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.7E-16234291No hitNo description
SuperFamilySSF579591.25E-11234290No hitNo description
CDDcd147041.17E-21235286No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
MIDSVVEVPP PAIDPDPNCS SEFDSVAIPP FDHLFLTGSD QEPVGNLTSD LWISLDGDEE  60
FDLTLDGIDD LYFPAENETF FIPATAATDR EHFGDFTPES EGSGISGDCI PGDEDKNANY  120
LSSSSGCSDR ESHRDSGDRC SGEERSLNPP SPISSQGSGN CGSGVSVTMN ALSPESETLM  180
VEQKVKVEEG GTAPITKRKK ESEEDTSGDS RTSKCRRSGD NASASDVTTE EDEKRNVRLM  240
RNRESAQLSR QRKKHYVEEL EEKVRTMHST IADLNSKISY FMAENATLRQ LGAGTGICPP  300
QHHPLSPPGM YPPMAPMHHP WMPCPPYMVK PQGSQMPLIP IPRLKPQQPV SVSKSKKSES  360
KKSEPKTKKV ASISFLGLLL CLFLFGALAP IVNINYGGIS GALYGEYRSD YITNQVLDQH  420
KGRVLDVNGR LSRSGDVDGS GTEFSNSNGA KCRIDTDGRA GKSMSVTDHV MPAGNDSEPL  480
VASLFVPRND KLVKIDGNLI IHSIVASEKA IATRKASETN NERKTVLSIP EDFSPALPRP  540
DVGRNGELAR AKDLYRTNSE KQKALSSGPA DNLKDHFKTT AANGKMQQWF REGLAGPMLS  600
SGMCTEVFQF DVSSTSGALI PASPASNVST EQSKNNTTNT DRGKSRRILR GLPVPLPGSG  660
PEFNLTENHT RKSSSQEGMG KPKPAAAGSS MVVSVLVDPR EGGEGEVDDG MMGQKSLSRV  720
FVVVLMDRVK YVTYSCVLPR PGDGPHLVTT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010554741.10.0PREDICTED: uncharacterized protein LOC104824380
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLV4MJL00.0V4MJL0_EUTSA; Uncharacterized protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein